PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0134s0420.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 475aa    MW: 54330.3 Da    PI: 4.5133
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0134s0420.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.5e-53171432128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                             ppGfrFhPtdeelvv+yLk+k+ +k+l+l ++++evd+yk++P++Lp +  +k+++++w+fFs+rd+ky++g r+nrat++gyWkat
  SapurV1A.0134s0420.4.p  17 PPGFRFHPTDEELVVYYLKRKICKKRLKL-NIVREVDVYKWDPEELPgQsILKTGDRQWFFFSPRDRKYPNGARSNRATRQGYWKAT 102
                             8****************************.89**************96446788999****************************** PP

                     NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             gkd+ v++ ++++vglkktLvfy+grap+g +tdWvmhey++
  SapurV1A.0134s0420.4.p 103 GKDRIVVC-NSRNVGLKKTLVFYRGRAPNGDRTDWVMHEYTM 143
                             ********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-609166IPR003441NAC domain
PROSITE profilePS5100555.46216166IPR003441NAC domain
PfamPF023653.9E-2817142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MKVTTDSFLG ADDMAWPPGF RFHPTDEELV VYYLKRKICK KRLKLNIVRE VDVYKWDPEE  60
LPGQSILKTG DRQWFFFSPR DRKYPNGARS NRATRQGYWK ATGKDRIVVC NSRNVGLKKT  120
LVFYRGRAPN GDRTDWVMHE YTMDEEELKR CPNVQDYYAL YKVYKKSGAG PKNGEQYGAP  180
FKEEDWVDDE FPRVNGLVTP EIPVKQHIEA TLVDNFKLSA PLELPLNDFE EIIKQIGGEH  240
AFNGLQNNDF SCLQPQVNGE EEAQSTLVDP CFREFVCEPV GELTTSDQHC NKHTNFNFDK  300
SDTSTLRLHE APEVTSATNY EQAPQLNEGD FLEINDLIDP EPYLSNAEQP VENLQFDDFD  360
GLSEFEQYHD AAMFLRDLGP VDQEAVSHSF MHPYGCDMVN QVGYQSQPDS IINAVDYQLQ  420
QSNLVASQVD CDLQPQFFDA EQMNNHLWVH GQRSNMSAAS ESHNGIFFQS PPGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-501417215171NO APICAL MERISTEM PROTEIN
1ut4_B5e-501417215171NO APICAL MERISTEM PROTEIN
1ut7_A5e-501417215171NO APICAL MERISTEM PROTEIN
1ut7_B5e-501417215171NO APICAL MERISTEM PROTEIN
3swm_A7e-501417218174NAC domain-containing protein 19
3swm_B7e-501417218174NAC domain-containing protein 19
3swm_C7e-501417218174NAC domain-containing protein 19
3swm_D7e-501417218174NAC domain-containing protein 19
3swp_A7e-501417218174NAC domain-containing protein 19
3swp_B7e-501417218174NAC domain-containing protein 19
3swp_C7e-501417218174NAC domain-containing protein 19
3swp_D7e-501417218174NAC domain-containing protein 19
4dul_A5e-501417215171NAC domain-containing protein 19
4dul_B5e-501417215171NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13443KRKICKKRLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302150.10.0no apical meristem family protein
RefseqXP_006386288.10.0hypothetical protein POPTR_0002s06210g
SwissprotQ9XIC51e-126NAC17_ARATH; NAC domain-containing protein 17
TrEMBLB9GT490.0B9GT49_POPTR; No apical meristem family protein
TrEMBLU5GKQ10.0U5GKQ1_POPTR; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-117NAC domain containing protein 17